PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g28830.1.p
Common NameBRADI_3g28830, LOC100826772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 253aa    MW: 28245.7 Da    PI: 8.9344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g28830.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.3e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W+++Ed+ll+d+++q+G ++W++ +++ g+ R++k+c++rw +yl
  Bradi3g28830.1.p 14 RGAWSPDEDQLLADYIAQHGHPNWRALPKHAGLLRCGKSCRLRWINYL 61
                      89******************************99************97 PP

2Myb_DNA-binding51.52.4e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T++E+++++++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  Bradi3g28830.1.p  67 RGNFTADEEDQIIRLHHSLGNR-WSAIAAQLP-GRTDNEIKNVWHTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.447961IPR017930Myb domain
SuperFamilySSF466892.61E-2811108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002497.1E-171461IPR001005SANT/Myb domain
CDDcd001671.24E-111661No hitNo description
PROSITE profilePS5129424.63762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2665116IPR009057Homeodomain-like
SMARTSM007172.6E-1466114IPR001005SANT/Myb domain
PfamPF002492.7E-1567112IPR001005SANT/Myb domain
CDDcd001674.76E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRAPCCDKE GLRRGAWSPD EDQLLADYIA QHGHPNWRAL PKHAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TADEEDQIIR LHHSLGNRWS AIAAQLPGRT DNEIKNVWHT HLKKRLLEDN  120
QKTTPGDGGR RQKKRKQKAK ATKSAPVSVK HEQLSPGRSS SSVTYNSTVT ETAAPVSSSP  180
AITSASHQLV KEESFSSAVV TDDSFWFSTD VTGMMNLGSM EEELSLAPTR NEDMDFWLKM  240
FESGDMRDLA VS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129135RRQKKRK
2129136RRQKKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519161e-107JF951916.1 Triticum urartu clone TaMYB33 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571882.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH47e-77MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLI1I4Q10.0I1I4Q1_BRADI; Uncharacterized protein
STRINGBRADI3G28830.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.15e-73myb domain protein 14